PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S03000.70
Common NameJCGZ_14129, LOC105642721
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family MYB
Protein Properties Length: 437aa    MW: 49113.6 Da    PI: 8.3934
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S03000.70genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.42.8e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l++ ++++G g+W+++++  g+ R++k+c++rw +yl
    Jcr4S03000.70 14 KGLWSPEEDEKLLRHITKYGHGCWSSVPKQAGLQRCGKSCRLRWINYL 61
                     678*******************************************97 PP

2Myb_DNA-binding44.43.9e-1467110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg ++++E+ l++++++ lG++ W+ Ia+ ++ gRt++++k+ w++
    Jcr4S03000.70  67 RGTFSQQEENLIIELHAVLGNR-WSQIAAQLP-GRTDNEIKNLWNS 110
                      899*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.4E-28664IPR009057Homeodomain-like
PROSITE profilePS5129425.116965IPR017930Myb domain
SuperFamilySSF466893.74E-2912108IPR009057Homeodomain-like
SMARTSM007172.7E-131363IPR001005SANT/Myb domain
PfamPF002493.2E-151461IPR001005SANT/Myb domain
CDDcd001671.25E-111761No hitNo description
Gene3DG3DSA:1.10.10.603.1E-2565116IPR009057Homeodomain-like
SMARTSM007177.8E-1366114IPR001005SANT/Myb domain
PROSITE profilePS5129420.40366116IPR017930Myb domain
PfamPF002494.1E-1367111IPR001005SANT/Myb domain
CDDcd001671.13E-869109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 437 aa     Download sequence    Send to blast
MGRHSCCYKQ KLRKGLWSPE EDEKLLRHIT KYGHGCWSSV PKQAGLQRCG KSCRLRWINY  60
LRPDLKRGTF SQQEENLIIE LHAVLGNRWS QIAAQLPGRT DNEIKNLWNS CLKKKLRQRG  120
IDPVTHKPLS EIENNGQDKN PSPTKKTQDK PSSELNLLEA RNSKPGLPNF QEKKQLEREE  180
GSASASNSKT ISSSSNNNNL VTPISNKDFF MDFPLQQLNY ASNARLSTNS IPSVWFTQTS  240
SKTFDMSSEF SSTSIPTILS PSNTTSSFLS TSMGFKPNSV TEDPSLASFP ITSSNLRFWE  300
TGAPSNTSSG SSGNAELQSN NSFFESTLFS WGLGDCSTTD KGQTQLITTQ QEDVKWPEYL  360
HSPLLMAAAL QNQNSQSLYN EIKSEAHFLE ENSNGMWPPP HHNQQLQQQQ QHQLAFQNSD  420
MCTNKDIQRL TAAYGHI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-27121165108B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1111117LKKKLRQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM0346580.0KM034658.1 Jatropha curcas clone JcMYB038 MYB family protein gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012083029.10.0PREDICTED: transcription factor MYB86
TrEMBLA0A067JZZ50.0A0A067JZZ5_JATCU; MYB family protein
STRINGPOPTR_0014s10680.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF108333103
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01680.32e-94myb domain protein 55
Publications ? help Back to Top
  1. Zhang L, et al.
    Global analysis of gene expression profiles in physic nut (Jatropha curcas L.) seedlings exposed to salt stress.
    PLoS ONE, 2014. 9(5): p. e97878
    [PMID:24837971]